DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG31827

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:269 Identity:68/269 - (25%)
Similarity:128/269 - (47%) Gaps:34/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ECSCGN---INTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHR- 131
            :|..||   :..:..:..|| .:..|:||.|.::...:...|.||:.....|||||.:   ::: 
  Fly    30 KCGYGNPDAVKVQFNVTEGQ-AKPAEFPWTIAVIHNRSLVGGGSLITPDIVLTAAHRI---FNKD 90

  Fly   132 ----LITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCM 192
                :::....|:..........:..|.:::||..::.:...:::||:..:....|...::.:|:
  Fly    91 VEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICL 155

  Fly   193 PTPSENYAGQTAVVTGWGALSEGGPISDT-----LQEVEVPI----LSQEECRNSNYGES-KITD 247
            ||...:.:....:|.|||...    .|||     |:::::||    :.|::.|.:..|:: .:..
  Fly   156 PTQKRSLSSTRCIVAGWGKYQ----FSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPR 216

  Fly   248 NMICAGYVEQGGK--DSCQGDSGGPMHVLGSGD--AYQLAGIVSWGEGCAKPNAPGVYTRVGSFN 308
            .:||||    |.|  |:|.||.||.:....:.|  .::..|||:||.||.:.|.|..||.|..|.
  Fly   217 GLICAG----GEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFK 277

  Fly   309 DWIAENTRD 317
            .||.:..::
  Fly   278 PWIVQQIKE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 63/247 (26%)
Tryp_SPc 83..314 CDD:238113 65/249 (26%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 63/243 (26%)
Tryp_SPc 50..280 CDD:214473 61/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457655
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.