DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG31780

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster


Alignment Length:398 Identity:97/398 - (24%)
Similarity:162/398 - (40%) Gaps:78/398 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCNFHLLLILATALGDLACAT-----PSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAE 60
            ||...:...:|....:|.|.:     |......:|..|:|              :.|..|:    
  Fly    46 MCKVKIEFRMAMTYRNLGCVSTAICCPKNLIIKEPRLIIN--------------EPITDPQ---- 92

  Fly    61 WSSPAKRECAECSCGNINT-------RHRIVG-GQETEVHEYPWMIMLM--WFGNFYCGASLVND 115
                         ||.:|:       |....| .||.||   |||:.|:  ...::..|.:|:..
  Fly    93 -------------CGFVNSKGVTFSFREEDTGLAQEAEV---PWMVALLDARTSSYVAGGALIAP 141

  Fly   116 QYALTAAHCVNGFYHRLITVRLLE--HNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFN 178
            ...:||...........:.||..|  .:.:...:..||..:..::.||.::..|..:::||:...
  Fly   142 HVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLR 206

  Fly   179 EPVRLGIDMHPVCMPTPSENYAGQTAVVTGWGALSEGGP-ISDTLQEVEVPILSQEECRNS---N 239
            ..:.....::|:|||:..:|:.....:.||||..|...| ..:.|:::.:|::.:..|...   .
  Fly   207 RSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLY 271

  Fly   240 YGESKITDN-MICAGYVEQGGKDSCQGDSGGPM--HVLGSGDAYQLAGIVSWGEGCAKPNAPGVY 301
            ||.....|| ::|||  .:.|||||:||.|.|:  .:..:...|:|||||::|..|..|..|.||
  Fly   272 YGNDFELDNSLMCAG--GEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVY 334

  Fly   302 TRVGSFNDWIAENT--------RDACSCAQPEAAGEPASPMETTEQGDQEN----TTANGAAEAD 354
            |.|.:..:||...|        |:....|.|..:..|     ...|.:|.|    .|......:.
  Fly   335 TNVANVIEWITLTTVNMPLPEEREEVPYASPTLSAGP-----YLNQWNQPNYEWLPTGYPNVNSI 394

  Fly   355 P-EVEEAN 361
            | :::|||
  Fly   395 PWQLQEAN 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 67/240 (28%)
Tryp_SPc 83..314 CDD:238113 69/242 (29%)
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 66/235 (28%)
Tryp_SPc 113..344 CDD:238113 66/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457667
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.