DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG31205

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:263 Identity:62/263 - (23%)
Similarity:110/263 - (41%) Gaps:42/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRHRIVGGQETEVHEYPWMIMLMWF-----GNFYCGASLVNDQYALTAAHCVNGFYHRLI 133
            ||..|.:.........|..|:||::.::..     ....|...|::.:..:||||||:......|
  Fly    29 CGIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESI 93

  Fly   134 TVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSEN 198
             ..::..:...|::.:    ||.|.:||.||.|.|::|:|:|...:.|.....:.|:|:|:.||.
  Fly    94 -YGVVFGDSDSSNINL----VSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEM 153

  Fly   199 YAGQTA-----VVTGWGALSEGGPISD----TLQEVEVPI------LSQEECRNSNYGESKITDN 248
            ..|...     :|.|.     .||..|    ..|.::..|      :..:||...   :::..:.
  Fly   154 VPGSETSNSKLIVAGL-----EGPSFDRRHSATQRLDKRIKMTYTKIDSKECHEK---QARFPEE 210

  Fly   249 MICAGYVEQGGKDSCQGDSGGPM-HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIA 312
            :|| |:.|:...      ||..: ...|:...:.|.||...|...:..:..| |..:....|||:
  Fly   211 LIC-GHTERSPL------SGSALTEASGTPRQFHLLGIAVAGFFSSDLDHQG-YLNIRPHLDWIS 267

  Fly   313 ENT 315
            :|:
  Fly   268 KNS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 56/249 (22%)
Tryp_SPc 83..314 CDD:238113 58/251 (23%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 34/128 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.