DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG32523

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:275 Identity:84/275 - (30%)
Similarity:131/275 - (47%) Gaps:42/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 IQSILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLV 113
            :|.|||.:|....|..|             ...|||||.:.:..::|..|.|...|..|||..::
  Fly    16 VQVILGQDVAQNQSESA-------------IEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVII 67

  Fly   114 NDQYALTAAHCVNGFYH-------RLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSD 171
            :..:.:||.|||.   |       .|.:::..........|:|   .|:.|::||.|:|.. .:|
  Fly    68 SATHVITAGHCVK---HGNDVVPADLWSIQAGSLLLSSDGVRI---PVAEVIMHPNYATGG-HND 125

  Fly   172 IALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAV-VTGWGALSEGGPISDTLQEVEVPILSQEEC 235
            :|::|...|  |..|.:...:...:|:.....|| ::|||.::|.||:||:|..|:|..:|:..|
  Fly   126 LAVLRLQSP--LTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGAC 188

  Fly   236 RNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVS--WGEGCAKPNAP 298
            |...|  |::.:.|||..:.:..|  :|.||||||....|     ::.|:.|  .|.||.:. ||
  Fly   189 RWMFY--SRLPETMICLLHSKNSG--ACYGDSGGPATYGG-----KVVGLASLLLGGGCGRA-AP 243

  Fly   299 GVYTRVGSFNDWIAE 313
            ..|.|:.....||||
  Fly   244 DGYLRISKVRAWIAE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 73/238 (31%)
Tryp_SPc 83..314 CDD:238113 76/241 (32%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 73/238 (31%)
Tryp_SPc 37..219 CDD:238113 60/194 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457785
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.