DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and C1s2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_776289.2 Gene:C1s2 / 317677 MGIID:3644269 Length:694 Species:Mus musculus


Alignment Length:310 Identity:98/310 - (31%)
Similarity:148/310 - (47%) Gaps:77/310 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 WIQSILGPEVPAEWSSPAKRECAECSCG----NINTRHRIVGGQETEVHEYPWMIMLMWFGNFYC 108
            |:...||.|:|         .|... ||    ....:.:|.|||..::..:||.:   :|.:...
Mouse   415 WVNDQLGIELP---------RCIPV-CGVPTEPFQVQQKIFGGQPAKIENFPWQV---FFNHPTA 466

  Fly   109 GASLVNDQYALTAAHCVN-----GFYHRLITVRLLE-HNRQDSHVKIVDRRVSRVLIHPKYS--- 164
            |.:|:|:.:.|||||.|.     ..|..:..:||.: .|.|..:.|       ||:|||.:.   
Mouse   467 GGALINEYWVLTAAHVVEKNSDPSMYAGITALRLADLENAQRLYTK-------RVIIHPGWKEDD 524

  Fly   165 ----TRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY---AGQTAVVTGWGALSEGGPISDTL 222
                ..|||:||||::..:||::|....|:|:|..|..|   .|...:::|||...:...:.: |
Mouse   525 DLNPRTNFDNDIALVQLKDPVKMGPKFSPICLPGTSSEYNLSPGDMGLISGWGRTEKRLHVIN-L 588

  Fly   223 QEVEVPILSQEEC----------RNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSG 277
            :..:||:.|.|.|          |..:|   .|||||||||   :.|.|||:|||||..      
Mouse   589 RGAKVPVTSLETCKQVKEENPTARPEDY---VITDNMICAG---EKGVDSCKGDSGGAF------ 641

  Fly   278 DAYQ----------LAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRD 317
             |:|          :||:||||:.|   .|.||||:|.::.|||.:..::
Mouse   642 -AFQVPNVKAPKFYVAGLVSWGKKC---GAYGVYTKVKNYVDWILKTMQE 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 88/264 (33%)
Tryp_SPc 83..314 CDD:238113 90/266 (34%)
C1s2NP_776289.2 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:291342
CUB 181..293 CDD:278839
CCP 300..361 CDD:153056
CCP 365..428 CDD:153056 5/21 (24%)
Tryp_SPc 443..681 CDD:214473 88/264 (33%)
Tryp_SPc 444..684 CDD:238113 90/266 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.