DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Klk15

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:249 Identity:100/249 - (40%)
Similarity:136/249 - (54%) Gaps:29/249 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHN--RQD 144
            :::.|:|...|..||.:.|...|.|.|||.|::.::.||||||..    |.:.|||.|||  :.|
Mouse    19 KVLEGEECVPHSQPWQVALFERGRFNCGAFLISPRWVLTAAHCQT----RFMRVRLGEHNLRKFD 79

  Fly   145 SHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVVTGW 209
            ...::  |.|||::.||.|..|....||.|:|..:|.||...:.||.:|.... ..|:..||:||
Mouse    80 GPEQL--RSVSRIIPHPGYEARTHRHDIMLLRLFKPARLTAYVRPVALPRRCP-LIGEDCVVSGW 141

  Fly   210 GALSEGGP-----------ISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSC 263
            |.||:..|           :.|||....:.|:|:..| |.:| ..::...|:||| ||.||.|||
Mouse   142 GLLSDNNPGATGSQKSHVRLPDTLHCANISIISEASC-NKDY-PGRVLPTMVCAG-VEGGGTDSC 203

  Fly   264 QGDSGGPMHVLGSGDAYQLAGIVSWGE-GCAKPNAPGVYTRVGSFNDWIAENTR 316
            :||||||: |.|..    |.||||||: .|.....|||||:|.|:.:||.||.|
Mouse   204 EGDSGGPL-VCGGA----LQGIVSWGDVPCDTTTKPGVYTKVCSYLEWIWENVR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 95/242 (39%)
Tryp_SPc 83..314 CDD:238113 97/244 (40%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 95/238 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.