DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG6048

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster


Alignment Length:381 Identity:123/381 - (32%)
Similarity:169/381 - (44%) Gaps:97/381 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FHLLLILATALGDLACATPS-LRSA----------------SDPEKILNNLAQLRQSSFLDWIQS 51
            |.|..:||.||  |....|| ||.|                :||.:|:|.               
  Fly     2 FGLGQLLAVAL--LLIFLPSGLRGATTRTHLDTKAIRPRFNADPGRIING--------------- 49

  Fly    52 ILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFY-CGASLVND 115
                              .|.|.|  .|||: ||.::.....|       :||..: ||.||:..
  Fly    50 ------------------TEASLG--ATRHQ-VGIRKALNDGY-------FFGTGHLCGGSLIRP 86

  Fly   116 QYALTAAHC------VNGFY---HRLITV--RLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFD 169
            .:.||||||      .:|.:   ...|.|  .|..:||.::....::.|:.::   .|:....:|
  Fly    87 GWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQL---DKFDLSTYD 148

  Fly   170 SDIALIRFNEPVRLGIDMHPVCMPTPSENYA---GQTAVVTGWGALSEGGPISDTLQEVEVPILS 231
            .||||:..|..|..|   ||...|.....:|   |....|||||. :|.|.:||.|..|:||::|
  Fly   149 KDIALLMLNGTVPTG---HPTIRPIALNRFAIPEGVVCQVTGWGN-TEDGYVSDILMTVDVPMIS 209

  Fly   232 QEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPN 296
            :|.|.|.:.....|...||||||:|.|.||:|.||||||: |..|    :|||:||||..||.|.
  Fly   210 EEHCINDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPL-VCQS----ELAGVVSWGIQCALPR 269

  Fly   297 APGVYTRVGSFNDWIAENTRDACSCAQPEAAGEPASPMETTEQGDQENTTANGAAE 352
            .|||||.|..:.|||.:|..:     ..|.:||.:.  |.:.:|..|. :..|:.|
  Fly   270 LPGVYTEVSYYYDWILQNMGE-----NGEGSGEESG--EGSGEGSGEG-SGEGSGE 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 90/243 (37%)
Tryp_SPc 83..314 CDD:238113 92/245 (38%)
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 98/293 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D19085at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.