DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG6041

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:265 Identity:81/265 - (30%)
Similarity:120/265 - (45%) Gaps:60/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGN--------FYCGASLVNDQYALTAAHC-------------- 124
            :||||.:..:.:..:.:.:....|        ..||..:::.:...|||||              
  Fly    34 KIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGE 98

  Fly   125 ----VNGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIAL------IRFNE 179
                :...|....|.|.|.:..|            :::.|..|:.....:||||      |.:|.
  Fly    99 FVLVMGSTYLTSSTDRTLMYYLQ------------QLITHENYNPDALTNDIALMFINGYIPWNW 151

  Fly   180 PVRLGIDMHPVCMPTPSENYAGQTAVVTGWGALSEGGPI-SDTLQEVEVPILSQEECRNSNYGES 243
            |....:.::...:.|.::      .:::|||.|.:.|.. |:|||...|||:|...||.|   .:
  Fly   152 PTVTALALNSQLVATNTD------CLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCRIS---YN 207

  Fly   244 KITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFN 308
            .|..:.:||||: .||.|:|||||||||...|     .||||||:|.|||.|..|||||.|..:.
  Fly   208 SIPVSQVCAGYL-SGGVDACQGDSGGPMSCNG-----MLAGIVSYGAGCAAPGYPGVYTNVSYYY 266

  Fly   309 DWIAE 313
            |||.:
  Fly   267 DWIVQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 79/261 (30%)
Tryp_SPc 83..314 CDD:238113 81/264 (31%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 79/261 (30%)
Tryp_SPc 35..272 CDD:238113 81/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.