DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and LOC312273

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:241 Identity:95/241 - (39%)
Similarity:135/241 - (56%) Gaps:26/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHN--RQD 144
            |||||...:.|..|:.:.|. .|:..||.||:.||:.|:||||    ||..:.|||.|||  ..:
  Rat    24 RIVGGYTCQEHSVPYQVSLN-AGSHICGGSLITDQWVLSAAHC----YHPQLQVRLGEHNIYEIE 83

  Fly   145 SHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMP--TPSENYAGQTAVVT 207
            ...:.:|  .:::::||.|.....|:||.||:...|..|...:..:.:|  .|:   ||...:|:
  Rat    84 GAEQFID--AAKMILHPDYDKWTVDNDIMLIKLKSPATLNSKVSTIPLPQYCPT---AGTECLVS 143

  Fly   208 GWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMH 272
            |||.|..|......||.::.|:||...|..:.  ..:||:||.|.|::| |||||||.|||||:.
  Rat   144 GWGVLKFGFESPSVLQCLDAPVLSDSVCHKAY--PRQITNNMFCLGFLE-GGKDSCQYDSGGPVV 205

  Fly   273 VLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDW----IAEN 314
            ..|     ::.||||||:|||....|||||:|.::.:|    ||||
  Rat   206 CNG-----EVQGIVSWGDGCALEGKPGVYTKVCNYLNWIHQTIAEN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 91/236 (39%)
Tryp_SPc 83..314 CDD:238113 92/238 (39%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 90/234 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.