DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG11664

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:251 Identity:56/251 - (22%)
Similarity:101/251 - (40%) Gaps:53/251 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 HRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDS 145
            ||   |...:...|.: :|.::...|....||.:.:|.||.|||             .:.|.:..
  Fly    24 HR---GIPVQQQNYGY-VMQIYGPQFLAAGSLFSARYVLTVAHC-------------FKKNTKPE 71

  Fly   146 HVKI-----------VDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVR-------LGIDMHPVCM 192
            .:.:           ..::|:.:|.|||:|.....:|||::|....:.       :|:...|:  
  Fly    72 ELSVRAGYRWIAWEFRGKQVAGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRPL-- 134

  Fly   193 PTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQ 257
             ||...:| ....:.||..:.    |:..|:.:.|.:..::.||.   ...:|:..:|||.... 
  Fly   135 -TPLNMFA-PPQELAGWNLMH----IAQPLKSMSVQVEPEKNCRQ---WFPQISGGVICASATM- 189

  Fly   258 GGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAE 313
             |:..|.||||.|:  :..|   ::.|:......|.....|.::|.|.....:||:
  Fly   190 -GEGLCYGDSGDPL--ISGG---EVCGLAIAFRKCGDKRYPALFTDVHYHRAFIAQ 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 53/246 (22%)
Tryp_SPc 83..314 CDD:238113 54/249 (22%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 51/231 (22%)
Tryp_SPc 38..237 CDD:214473 50/229 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.