DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tmprss3

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_038954650.1 Gene:Tmprss3 / 309665 RGDID:1310135 Length:454 Species:Rattus norvegicus


Alignment Length:313 Identity:112/313 - (35%)
Similarity:169/313 - (53%) Gaps:22/313 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LACAT---PSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRE-CA------- 70
            :|||.   ||..| ||..:: :.|.:..|..|:.....:...:|.|...|...|| |.       
  Rat   140 IACAQLGFPSYVS-SDHLRV-DALEEQFQGDFVSINHLLPDDKVTALHHSVYMREGCTSGHVVTL 202

  Fly    71 ECSCGNINTRH--RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYH-RL 132
            :||...:.|.:  |||||..:.:.::||.:.|.:.|...||.|::...:.:||||||...|| :.
  Rat   203 KCSACGMRTGYSPRIVGGNVSSLTQWPWQVSLQFQGYHLCGGSVITPLWIVTAAHCVYDLYHPKS 267

  Fly   133 ITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSE 197
            .||::...:..||.|.  ...|.:::.|.||..:...:||||::.:||:.....:.|:|:|...|
  Rat   268 WTVQVGLVSLMDSPVP--SHLVEKIIYHSKYKPKRLGNDIALMKLSEPLTFDETIQPICLPNSEE 330

  Fly   198 NYA-GQTAVVTGWGALSEG-GPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGK 260
            |:. |:....:||||..:| |..|..|....||::|.:.|.:.:.....|:.:|:||||: :||.
  Rat   331 NFPDGKLCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYL-KGGV 394

  Fly   261 DSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAE 313
            ||||||||||: |......::|.|..|:|.|||:.|.||||||:.||.|||.|
  Rat   395 DSCQGDSGGPL-VCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWIHE 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 89/231 (39%)
Tryp_SPc 83..314 CDD:238113 91/234 (39%)
Tmprss3XP_038954650.1 LDLa 74..107 CDD:238060
SRCR_2 112..211 CDD:406055 19/72 (26%)
Tryp_SPc 216..444 CDD:214473 89/231 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45531
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.