DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss30

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:328 Identity:122/328 - (37%)
Similarity:165/328 - (50%) Gaps:66/328 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SLRSASDPEKILNNLAQLRQS----SFLDWIQSILGPEVPAEWSSPAKRECAECSCGNINTRHRI 83
            :|.|...|:.|::.|. ||:|    .:..|.:..:.|.|                ||:.....:|
Mouse    27 ALGSTPHPQWIVDGLT-LRRSYAGFFYNGWARGDILPSV----------------CGHSRDAGKI 74

  Fly    84 VGGQETEVHEYPWMIMLMWF--GNFYCGASLVNDQYALTAAHCVN-----GFYHRLI---TVRLL 138
            ||||:....::||.:.| |.  ....||.||:::.:.||||||..     .|||..:   |:.||
Mouse    75 VGGQDALEGQWPWQVSL-WITEDGHICGGSLIHEVWVLTAAHCFRRSLNPSFYHVKVGGLTLSLL 138

  Fly   139 EHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDS-DIALIRFNEPVRLGIDMHPVCMP------TPS 196
            |     .|..:|  .|..:.:||.|...:..| ||||::.:.|:|.. ...|||:|      || 
Mouse   139 E-----PHSTLV--AVRNIFVHPTYLWADASSGDIALVQLDTPLRPS-QFTPVCLPAAQTPLTP- 194

  Fly   197 ENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECR-------NSNYGESKITDNMICAGY 254
                |....||||||..| ..::..|||:.||:|..|:|.       :|..||..|..:|:||||
Mouse   195 ----GTVCWVTGWGATQE-RDMASVLQELAVPLLDSEDCEKMYHTQGSSLSGERIIQSDMLCAGY 254

  Fly   255 VEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI----AENT 315
            || |.|||||||||||: |.....::...||.|||.|||:|..|||||||.::.|||    |||.
Mouse   255 VE-GQKDSCQGDSGGPL-VCSINSSWTQVGITSWGIGCARPYRPGVYTRVPTYVDWIQRILAENH 317

  Fly   316 RDA 318
            .||
Mouse   318 SDA 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 102/252 (40%)
Tryp_SPc 83..314 CDD:238113 105/258 (41%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 104/254 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3952
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.