DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Klk8

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:239 Identity:89/239 - (37%)
Similarity:124/239 - (51%) Gaps:27/239 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSH 146
            :|:.|||.:.|..||...|.......||..||.|::.||||||....|    :|||.:|:.|...
  Rat    32 KILEGQECKPHSQPWQTALFQGERLVCGGVLVGDRWVLTAAHCKKDKY----SVRLGDHSLQKRD 92

  Fly   147 VKIVDRRVSRVLIHPKYSTRN---FDSDIALIRFNEPVRLGIDMHPVCMPT--PSENYAGQTAVV 206
            ....:.:|:|.:.||.:::.|   ...||.|||......||..:.|:.:..  |.   .||..::
  Rat    93 EPEQEIQVARSIQHPCFNSSNPEDHSHDIMLIRLQNSANLGDKVKPIELANLCPK---VGQKCII 154

  Fly   207 TGWGALS---EGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSG 268
            :|||.::   |..|  :||...||.|.||.:|..:..|  |||:.|:|||  ...|.|:||||||
  Rat   155 SGWGTVTSPQENFP--NTLNCAEVKIYSQNKCERAYPG--KITEGMVCAG--SSNGADTCQGDSG 213

  Fly   269 GPMHVLGSGDAYQLAGIVSWG-EGCAKPNAPGVYTRVGSFNDWI 311
            ||:...|     .|.||.||| :.|.||..|||||::..:.:||
  Rat   214 GPLVCNG-----VLQGITSWGSDPCGKPEKPGVYTKICRYTNWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 87/237 (37%)
Tryp_SPc 83..314 CDD:238113 89/238 (37%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 87/237 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.