DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and F12

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001014028.1 Gene:F12 / 306761 RGDID:1359175 Length:603 Species:Rattus norvegicus


Alignment Length:322 Identity:109/322 - (33%)
Similarity:156/322 - (48%) Gaps:39/322 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 CATPSLRSASDPE-----KILNNLAQLRQ----SSFLDWIQSILGPEVPAEWSSPAKRECAECSC 74
            |..|:|.|...||     |....:.|:.|    |..||  .|.....|.:..|:..   |.:...
  Rat   294 CQMPTLTSPVSPESHDMLKPRPPILQMPQFPSLSDALD--NSTRNQNVVSRTSTVV---CGQRFR 353

  Fly    75 GNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLE 139
            ..:::..|:|||.......:|::..|.| |:.:|..||::..:.||||||:.   .|.....|..
  Rat   354 KRLSSLRRVVGGLVALPGSHPYIAALYW-GDSFCAGSLIDPCWVLTAAHCLQ---KRPAPEELTV 414

  Fly   140 HNRQDSHVKIVDR----RVSRVLIHPKYSTRNFDSDIALIRF----NEPVRLGIDMHPVCMPT-- 194
            ...||.|.:..:|    .|....:|..:|::.:..|:||:|.    |....|...:.|||:|:  
  Rat   415 VLGQDRHNQSCERCQTLAVHSYRLHEGFSSKTYQHDLALLRLRGRKNSCAILSPHVQPVCLPSSA 479

  Fly   195 --PSENYAGQTAVVTGWGALSEGGPISDT-LQEVEVPILSQEECRNSNYGESKITDNMICAGYVE 256
              |||....:   |.|||...||.....| |||.:||.:|.:.|.:||.....|...|:|||::|
  Rat   480 APPSETVLCE---VAGWGHQFEGAEEYATFLQEAQVPFISLDRCSSSNVHGDAILPGMLCAGFLE 541

  Fly   257 QGGKDSCQGDSGGPMHVLGSGDAYQ---LAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
             ||.|:||||||||: |...|...:   |.|::|||.||...|.|||||.|.::.|||.|:|
  Rat   542 -GGADACQGDSGGPL-VCDEGVTERQLTLRGVISWGSGCGDRNKPGVYTDVANYLDWIQEHT 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 89/244 (36%)
Tryp_SPc 83..314 CDD:238113 90/246 (37%)
F12NP_001014028.1 FN2 40..87 CDD:238019
EGF_CA 95..130 CDD:238011
FN1 132..170 CDD:238018
EGF 177..207 CDD:278437
Kringle 216..294 CDD:278480 109/322 (34%)
Tryp_SPc 361..597 CDD:214473 89/244 (36%)
Tryp_SPc 362..600 CDD:238113 90/246 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.