DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tpsg1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:259 Identity:90/259 - (34%)
Similarity:125/259 - (48%) Gaps:40/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRH---RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITV 135
            ||.....|   |||||...:...:||...|.......||.||::.::.||||||.:|        
  Rat    18 CGQPQVSHAGSRIVGGHAAQAGAWPWQASLRLQKVHVCGGSLLSPEWVLTAAHCFSG-------- 74

  Fly   136 RLLEHNRQDSHVKIVDRRVSRVLIHPKYST-------------RNFDSDIALIRFNEPVRLGIDM 187
               ..|..|..|.:.:..::   :.|.:||             .....||||::...||.|...:
  Rat    75 ---SVNSSDYEVHLGELTIT---LSPHFSTVKQIIMYSSAPGPPGSSGDIALVQLATPVALSSQV 133

  Fly   188 HPVCMPTPSENY-AGQTAVVTGWGALSEGGPISD--TLQEVEVPILSQEECRN--SNYGESKITD 247
            .|||:|..|.:: .|....|||||...||.|:..  .|||.:|.::..|.|..  |:...|.|..
  Rat   134 QPVCLPEASADFHPGMQCWVTGWGYTQEGEPLKPPYNLQEAKVSVVDVETCSQAYSSSNGSLIQS 198

  Fly   248 NMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            :|:||    .|..|:||.|||||: |......:|.||:|||||||.:|:.||||.||.::.:||
  Rat   199 DMLCA----WGPGDACQDDSGGPL-VCRVAGIWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 85/246 (35%)
Tryp_SPc 83..314 CDD:238113 86/247 (35%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 85/246 (35%)
Tryp_SPc 30..260 CDD:238113 86/247 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346434
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.