DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss22

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001100454.1 Gene:Prss22 / 302971 RGDID:1310880 Length:307 Species:Rattus norvegicus


Alignment Length:251 Identity:87/251 - (34%)
Similarity:149/251 - (59%) Gaps:19/251 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGF------YHRL 132
            ||.....:|:|||:::...::||::.::..|:.:|..||:.:::.::||||.:..      |..|
  Rat    41 CGKPQQLNRVVGGEDSADAQWPWIVSILKNGSHHCAGSLLTNRWVVSAAHCFSSNMDKPSPYSVL 105

  Fly   133 ITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTR-NFDSDIALIRFNEPVRLGIDMHPVCMPTPS 196
            :....|.:....|. |:   .::.||.||:||.: ...:||||:|...|::....:.|:|:|..|
  Rat   106 LGAWKLGNPGPRSQ-KV---GIASVLPHPRYSRKEGTHADIALVRLERPIQFSERILPICLPDSS 166

  Fly   197 ENYAGQT-AVVTGWGALSEGGPI--SDTLQEVEVPILSQEECRNSNY---GESKITDNMICAGYV 255
            .:....| ..:.|||::.:|.|:  ..|||:::|||:..|.|::..:   |:..||::|:||||:
  Rat   167 VHLPPNTNCWIAGWGSIQDGVPLPRPQTLQKLKVPIIDPELCKSLYWRGAGQEAITEDMLCAGYL 231

  Fly   256 EQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            | |.:|:|.||||||: :....|.:.|.||:|||||||:.|.|||||.:.:...|:
  Rat   232 E-GKRDACLGDSGGPL-MCQVDDHWLLTGIISWGEGCAERNRPGVYTSLLAHRPWV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 84/241 (35%)
Tryp_SPc 83..314 CDD:238113 84/242 (35%)
Prss22NP_001100454.1 Tryp_SPc 49..285 CDD:214473 84/241 (35%)
Tryp_SPc 50..288 CDD:238113 84/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.