DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss32

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001100453.1 Gene:Prss32 / 302970 RGDID:1311905 Length:334 Species:Rattus norvegicus


Alignment Length:284 Identity:104/284 - (36%)
Similarity:150/284 - (52%) Gaps:25/284 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILGPEVPAEWSSPAKRECAECS------CGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGA 110
            :||.||....|.....:....|      ||......|||.||..::.::||.:.:...|...||.
  Rat    17 LLGSEVLTTDSYSLSTQTGRSSIDLDSVCGRPRASGRIVSGQNAQLGQWPWQVSVREDGVHVCGG 81

  Fly   111 SLVNDQYALTAAHCVNGFYH-RLITVRL--LEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDS-D 171
            ||:::.:.||||||.|...| ...||.|  :....:|:..:.: |.|::.:.:|.||.....| |
  Rat    82 SLISEDWVLTAAHCFNQDQHLSAYTVLLGTISSYPEDNEPREL-RAVAQYIKYPSYSAEEHSSGD 145

  Fly   172 IALIRFNEPVRLGIDMHPVCMPTPSENY-AGQTAVVTGWGALSEGGPISD--TLQEVEVPILSQE 233
            |||::...|:.....|.|||:|.|.:.. .|....|||||.::...|:..  ||||::||::..:
  Rat   146 IALLQLASPISFNDYMLPVCLPKPGDPLDPGTMCWVTGWGNIATNQPLPPPFTLQELQVPLIDAK 210

  Fly   234 ECRNSNYGESK-------ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEG 291
            .| |:.|.|:.       |.::|:|||:|| |.||:|.||||||: |....|.:..||:||||..
  Rat   211 TC-NTYYQENSVPSTEQVILEDMLCAGFVE-GKKDACNGDSGGPL-VCDVNDVWIQAGVVSWGSD 272

  Fly   292 CAKPNAPGVYTRVGSFNDWIAENT 315
            ||..|.|||||.|..:..|| :||
  Rat   273 CALSNRPGVYTNVSVYISWI-QNT 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 92/242 (38%)
Tryp_SPc 83..314 CDD:238113 93/244 (38%)
Prss32NP_001100453.1 Tryp_SPc 53..292 CDD:214473 92/242 (38%)
Tryp_SPc 54..295 CDD:238113 93/245 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.