DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and HABP2

DIOPT Version :10

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_004123.1 Gene:HABP2 / 3026 HGNCID:4798 Length:560 Species:Homo sapiens


Alignment Length:246 Identity:53/246 - (21%)
Similarity:87/246 - (35%) Gaps:55/246 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   941 FSQDQHGSRFIQQ---KLERAISVEKQLVFNEILGAAYSLMTDVFGNYVI---QKFFEFGSPEQK 999
            |..|:.|..|...   |:.:.|...::....|..|.||..::.:..:..:   :|.|:....|:.
Human   526 FGCDECGKAFRNNSGLKVHKRIHTGERPYKCEECGKAYISLSSLINHKSVHPGEKPFKCDECEKA 590

  Fly  1000 ----QALAQQVKGHVLPLALQMYGCRVIQKALE--SIPAEQQQEIVRELDGHVLKCVKDQNGN-- 1056
                :.|....|.|   |..:.|.|.|.:|:..  |:.::.::...||......:|.|....|  
Human   591 FITYRTLLNHKKIH---LGEKPYKCDVCEKSFNYTSLLSQHKRVHTREKPFECDRCEKVFRNNSS 652

  Fly  1057 -------HVVQKCIECVDPVALQFIIDAFRNQVYSLSTH----PYGCRVIQRILEHCTPEQTAPI 1110
                   |..:|..|| |.....:|  :..:.:...|||    ||.|       :.|.....:..
Human   653 LKVHKRIHTGEKPYEC-DICGKAYI--SHSSLINHKSTHPGKTPYTC-------DECGKAFFSSR 707

  Fly  1111 LAELHANTEHLIQDQYGNYVIQHVLEHGKPEDKSALIASVRGKVLILSQHK 1161
            ....|... ||.:..:      ..:|.||....|:|          |||||
Human   708 TLISHKRV-HLGEKPF------KCVECGKSFSYSSL----------LSQHK 741

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 83..314 CDD:238113
HABP2NP_004123.1 EGF 77..106 CDD:394967
KR 191..277 CDD:238056
Tryp_SPc 314..553 CDD:238113 6/26 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.