DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss42

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001100333.2 Gene:Prss42 / 301027 RGDID:1562548 Length:340 Species:Rattus norvegicus


Alignment Length:263 Identity:93/263 - (35%)
Similarity:137/263 - (52%) Gaps:38/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSH 146
            :|:||.:.|..::||.:.|.......||.||:|.|:.||||||:              |:|...:
  Rat    83 KIMGGVDAEEGKWPWQVSLRVRHMHVCGGSLLNSQWVLTAAHCI--------------HSRVQYN 133

  Fly   147 VKIVDRRVSR-----------VLIHPKYSTRN-FDSDIALIRFNEPVRLGIDMHPVCMPTPSENY 199
            ||:.||.|.|           :.:|||:||.. ..:||||::..:||.....:||:|:||.:.:.
  Rat   134 VKMGDRSVYRQNTSLVIPIQNIFVHPKFSTTTVVQNDIALLKLQQPVNFTSSIHPICVPTGTFHV 198

  Fly   200 -AGQTAVVTGWGALSEGGP--ISDTLQEVEVPILSQEEC-----RNSNYGESKITDNMICAGYVE 256
             ||....|||||....|.|  .::.||||:..|:..|||     :.::.....:...|:||  .:
  Rat   199 KAGTKCWVTGWGKPDPGAPQIPTEILQEVDQSIILYEECNEMLKKMASTSVDLVKRGMVCA--YK 261

  Fly   257 QGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRDACSC 321
            :||||:||||||||:.........|: |:||||.||.:...|||||.|..:|.|:. ...:..:|
  Rat   262 EGGKDACQGDSGGPLSCEFDNRWVQI-GVVSWGIGCGRKGHPGVYTDVAFYNKWLI-TVVNQTAC 324

  Fly   322 AQP 324
            ..|
  Rat   325 LHP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 90/248 (36%)
Tryp_SPc 83..314 CDD:238113 91/250 (36%)
Prss42NP_001100333.2 Tryp_SPc 83..314 CDD:214473 90/247 (36%)
Tryp_SPc 84..315 CDD:238113 90/247 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.