DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Klk1c10

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001128645.1 Gene:Klk1c10 / 292858 RGDID:1561403 Length:259 Species:Rattus norvegicus


Alignment Length:261 Identity:89/261 - (34%)
Similarity:136/261 - (52%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SCGNINT----RHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLI 133
            |.|.|:.    :.|||||.:.|.:..||.:.::  ..:.||..|::..:.:|||||.:.:||   
  Rat    11 SLGGIDAAPPGQSRIVGGYKCEKNSQPWQVAII--NEYLCGGVLIDPSWVITAAHCYSNYYH--- 70

  Fly   134 TVRLLEHNRQDSHVKIVDRRVSRVLIHPKYS-------TR----NFDSDIALIRFNEPVRLGIDM 187
             |.|..:|..:.......|.|::...||.|.       ||    ::.:|:.|:..:||..:...:
  Rat    71 -VLLGRNNLFEDEPFAQYRFVNQSFPHPDYKPFLMRNHTRQRGDDYSNDLMLLHLSEPADITDGV 134

  Fly   188 HPVCMPTPSENYAGQTAVVTGWGALSEGGPIS----DTLQEVEVPILSQEECRNSNYGESKITDN 248
            ..:.:|| .|...|.|.:.:|||:..   |::    |.||.|.:.:||.|:|..:.  |.|:||.
  Rat   135 KVIDLPT-EEPKVGSTCLASGWGSTK---PLNWELPDDLQCVNIHLLSNEKCIEAY--EQKVTDL 193

  Fly   249 MICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGE-GCAKPNAPGVYTRVGSFNDWIA 312
            |:|||.:: |.||:|:||||||:...|     .|.||.|||. .||:|..|||||::..|..||.
  Rat   194 MLCAGEMD-GRKDTCKGDSGGPLICDG-----VLQGITSWGNVPCAEPYNPGVYTKLIKFTSWIK 252

  Fly   313 E 313
            |
  Rat   253 E 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 83/244 (34%)
Tryp_SPc 83..314 CDD:238113 85/247 (34%)
Klk1c10NP_001128645.1 Tryp_SPc 24..251 CDD:214473 83/244 (34%)
Tryp_SPc 25..254 CDD:238113 85/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.