DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Klk1c12

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_017444409.1 Gene:Klk1c12 / 292855 RGDID:1303192 Length:262 Species:Rattus norvegicus


Alignment Length:264 Identity:81/264 - (30%)
Similarity:127/264 - (48%) Gaps:41/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SCGNINT----RHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVN---GFYH 130
            |.|.|:.    :.|:|||.:.|.:..||.:.::  ..:.||..|::..:.:|||||.:   ..||
  Rat    11 SVGRIDAAPPGQSRVVGGYKCEKNSQPWQVAVI--NRYLCGGVLIDPSWVITAAHCYSHALSNYH 73

  Fly   131 RLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYST-----------RNFDSDIALIRFNEPVRLG 184
            .|:....|..:...:..:.|::...    ||.|:.           .:..:|:.|:..:||..:.
  Rat    74 VLLGRNNLFKDEPFAQYRFVNQSFP----HPDYNPFFMKNHTLFPGDDHSNDLMLLHLSEPADIT 134

  Fly   185 IDMHPVCMPTPSENYAGQTAVVTGWGALSEGGPIS----DTLQEVEVPILSQEECRNSNYGESKI 245
            ..:..:.:|| .|...|.|.:.:||   |...|:.    |.||.|.:.|||.|:|..::  ...:
  Rat   135 DGVKVIDLPT-EEPKVGSTCLASGW---SSTKPLEWEFPDDLQCVNINILSNEKCIKAH--TQMV 193

  Fly   246 TDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGE-GCAKPNAPGVYTRVGSFND 309
            ||.|:|||.:| ||||:|.||||||:...|     .|.||.||.. .|.:.|.|.:||::..|..
  Rat   194 TDVMLCAGELE-GGKDTCNGDSGGPLLCDG-----VLQGITSWSSVPCGETNRPAIYTKLIKFTS 252

  Fly   310 WIAE 313
            ||.|
  Rat   253 WIKE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 75/247 (30%)
Tryp_SPc 83..314 CDD:238113 77/250 (31%)
Klk1c12XP_017444409.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.