DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Klk10

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:232 Identity:70/232 - (30%)
Similarity:109/232 - (46%) Gaps:33/232 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIVD----RRVS 155
            ||.:.|.....|.|...||:..:.||||||   :.::.:..|:     .|.|:.:..    |..:
  Rat    59 PWQVSLFHNLQFQCAGVLVDQNWVLTAAHC---WRNKPLRARV-----GDDHLLLFQSEQLRSTN 115

  Fly   156 RVLIHPKYS--------TRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVVTGWGAL 212
            ..:.||||.        .|:.:.|:.:::.:.||.|...:|||.:|..... ..|...|:|||..
  Rat   116 SPVFHPKYQPCSGPVLPLRSDEHDLMMLKLSSPVVLTSKVHPVQLPFQCAQ-PRQECQVSGWGTT 179

  Fly   213 SEGG-PISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGS 276
            :... ..:.:|....|.:|||::|  ..:....||:||||||.  ...:||||.|||||:....:
  Rat   180 ANRRVKYNRSLSCSRVTLLSQKQC--ETFYPGVITNNMICAGM--DRDQDSCQSDSGGPLVCDNT 240

  Fly   277 GDAYQLAGIVSWG-EGC-AKPNAPGVYTRVGSFNDWI 311
                 |.||:||. ..| |....|.||.::.::.:||
  Rat   241 -----LHGILSWSIYPCGAATQYPAVYAKICNYTNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 68/230 (30%)
Tryp_SPc 83..314 CDD:238113 70/232 (30%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 68/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.