DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tpsb2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:253 Identity:95/253 - (37%)
Similarity:139/253 - (54%) Gaps:28/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 INTRHRIVGGQETEVHEYPWMIMLMW---FGNFYCGASLVNDQYALTAAHCVNGFYHR---LITV 135
            :..|..||||:|....::||.:.|.:   |...:||.||::.|:.||||||| |.:.:   |..|
  Rat    24 VKQRVGIVGGREASESKWPWQVSLRFKFSFWMHFCGGSLIHPQWVLTAAHCV-GLHIKSPELFRV 87

  Fly   136 RLLEHNRQDSHVKIVDR--RVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSEN 198
            :|     ::.::...|:  .|:|.::||.|.|....:||||:....||.:...:||..:|..||.
  Rat    88 QL-----REQYLYYADQLLTVNRTVVHPHYYTVEDGADIALLELENPVNVSTHIHPTSLPPASET 147

  Fly   199 Y-AGQTAVVTGWGALSEGGPISD--TLQEVEVPILSQEECRNSNY-----GESK--ITDNMICAG 253
            : :|.:..|||||.:....|:..  .|::|:|||:....|....:     |:..  :.|.|:|||
  Rat   148 FPSGTSCWVTGWGDIDSDEPLLPPYPLKQVKVPIVENSLCDRKYHTGLYTGDDVPIVQDGMLCAG 212

  Fly   254 YVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            ...   .||||||||||:.....|...| ||:||||||||:.|.||:||||..:.|||
  Rat   213 NTR---SDSCQGDSGGPLVCKVKGTWLQ-AGVVSWGEGCAEANRPGIYTRVTYYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 92/246 (37%)
Tryp_SPc 83..314 CDD:238113 94/247 (38%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 94/247 (38%)
Tryp_SPc 30..266 CDD:214473 92/245 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.