DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Mcpt1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_058841.1 Gene:Mcpt1 / 29265 RGDID:3062 Length:247 Species:Rattus norvegicus


Alignment Length:246 Identity:78/246 - (31%)
Similarity:118/246 - (47%) Gaps:30/246 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IVGGQETEVHEYPWMIMLMWFG----NFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHN-- 141
            |:||.|:..|..|:|..|....    ...||..|:..|:.||||||..    |.|||.|..|:  
  Rat    21 IIGGVESIPHSRPYMAHLDIITERGLKDSCGGFLITRQFVLTAAHCRG----REITVTLGAHDVS 81

  Fly   142 -RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRL--GIDMHPVCMPTPSE-NYAGQ 202
             |:.:..||   :|.:..||..|:......||.|::..:.|.|  .:|:.|  :|:||: .:.|.
  Rat    82 KREYTQQKI---KVEKQFIHKNYNFLPNLHDIMLLKLEKQVELTPAVDVVP--LPSPSDFIHPGT 141

  Fly   203 TAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDS 267
            .....|||......|.||||:||.:.|:.:|.|:...:.::..   .:|.| :....:.:..|||
  Rat   142 LCWTAGWGRTGVKDPTSDTLREVALRIMDEEACKIYRHYDNNF---QVCVG-LSTRLQTAYTGDS 202

  Fly   268 GGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRDA 318
            |||:...|     .:.||||:|...|.|  |.|:||:..:..||....|::
  Rat   203 GGPLLCAG-----VVHGIVSYGHPDATP--PAVFTRIAPYVPWINTVLRES 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 75/237 (32%)
Tryp_SPc 83..314 CDD:238113 77/240 (32%)
Mcpt1NP_058841.1 Tryp_SPc 20..239 CDD:214473 75/237 (32%)
Tryp_SPc 21..242 CDD:238113 77/240 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.