DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Gzmm

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_476531.1 Gene:Gzmm / 29252 RGDID:620022 Length:264 Species:Rattus norvegicus


Alignment Length:240 Identity:74/240 - (30%)
Similarity:128/240 - (53%) Gaps:24/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLE--HNRQD 144
            :|:||:|...|..|:|:.|....:..||..||:.::.||||||::....:|..|..|.  |:.||
  Rat    26 QIIGGREAVPHSRPYMVSLQNTKSHVCGGVLVHQKWVLTAAHCLSEPLQQLKLVFGLHSLHDPQD 90

  Fly   145 SHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMP-----TPSENYAGQTA 204
            ..:...   :.:.:.||.|:.: :::|:||::.:..|:...::.|:.:|     .|:|   |...
  Rat    91 PGLTFY---IKQAIKHPGYNLK-YENDLALLKLDGRVKPSKNVKPLALPRKPRDKPAE---GSRC 148

  Fly   205 VVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMIC--AGYVEQGGKDSCQGDS 267
            ...|||...:.|.::.:|||:::.:|....|.||.:....:||:|:|  ||   ..|:..|:|||
  Rat   149 STAGWGITHQRGQLAKSLQELDLRLLDTRMCNNSRFWNGVLTDSMLCLKAG---AKGQAPCKGDS 210

  Fly   268 GGPMHVLGSGDAYQLAGIVSW-GEGCAKPNAPGVYTRVGSFNDWI 311
            |||: |.|.|   ::.||:|: .:.|.....|.|.|.|..::.||
  Rat   211 GGPL-VCGKG---KVDGILSFSSKNCTDIFKPTVATAVAPYSSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 72/238 (30%)
Tryp_SPc 83..314 CDD:238113 74/239 (31%)
GzmmNP_476531.1 Tryp_SPc 27..254 CDD:238113 74/239 (31%)
Trypsin 27..251 CDD:278516 72/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.