DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Hpn

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_038958880.1 Gene:Hpn / 29135 RGDID:61982 Length:559 Species:Rattus norvegicus


Alignment Length:297 Identity:99/297 - (33%)
Similarity:140/297 - (47%) Gaps:50/297 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLI 133
            |.:|....:.. .||||||::.:..:||.:.|.:.|...||.||::..:.||||||         
  Rat   191 CQDCGRRKLPV-DRIVGGQDSSLGRWPWQVSLRYDGTHLCGGSLLSGDWVLTAAHC--------- 245

  Fly   134 TVRLLEHNRQDSHVKIVDRRVSR------------VLIHPKY------STRNFDSDIALIRFNEP 180
               ..|.||..|..::....|:|            |:.|..|      :.....:||||:..:..
  Rat   246 ---FPERNRVLSRWRVFAGAVARTSPHAVQLGVQAVIYHGGYLPFRDPTIDENSNDIALVHLSSS 307

  Fly   181 VRLGIDMHPVCMPTPSENYA-GQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESK 244
            :.|...:.|||:|...:... |:...|||||.....|..:..|||..|||:|.|.|.:.::..::
  Rat   308 LPLTEYIQPVCLPAAGQALVDGKVCTVTGWGNTQFYGQQAVVLQEARVPIISNEVCNSPDFYGNQ 372

  Fly   245 ITDNMICAGYVEQGGKDSCQGDSGGPM----HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVG 305
            |...|.||||.| ||.|:||||||||.    .:.|: ..::|.||||||.|||....|||||:|.
  Rat   373 IKPKMFCAGYPE-GGIDACQGDSGGPFVCEDRISGT-SRWRLCGIVSWGTGCALARKPGVYTKVI 435

  Fly   306 SFNDWIAENTRDACSCAQPEAAG--------EPASPM 334
            .|.:||.:    |...:..|..|        .|..|:
  Rat   436 DFREWIFQ----AIKASGDETLGTECWENRLRPGKPV 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 90/251 (36%)
Tryp_SPc 83..314 CDD:238113 91/253 (36%)
HpnXP_038958880.1 Hepsin-SRCR 92..200 CDD:401275 2/8 (25%)
Tryp_SPc 204..441 CDD:238113 89/250 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12330
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.