DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and PRSS50

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_037402.1 Gene:PRSS50 / 29122 HGNCID:17910 Length:385 Species:Homo sapiens


Alignment Length:380 Identity:97/380 - (25%)
Similarity:152/380 - (40%) Gaps:84/380 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLILATALGDLAC----ATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAE-----WS 62
            ||:|...|....|    ..|...|.:||..         ||     :|.:.....|:.     |.
Human    25 LLLLLLLLRSAGCWGAGEAPGALSTADPAD---------QS-----VQCVPKATCPSSRPRLLWQ 75

  Fly    63 SPAKRECAEC-----------------SCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGA 110
            :|..:.....                 |||....:...:...|.....:|||:.:...|...|..
Human    76 TPTTQTLPSTTMETQFPVSEGKVDPYRSCGFSYEQDPTLRDPEAVARRWPWMVSVRANGTHICAG 140

  Fly   111 SLVNDQYALTAAHCVNGFYHRLI-TVRL----LEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDS 170
            :::..|:.||.|||:  .:..:| :||:    ::...|.:.    |..|.:|::|.:|..:.|.|
Human   141 TIIASQWVLTVAHCL--IWRDVIYSVRVGSPWIDQMTQTAS----DVPVLQVIMHSRYRAQRFWS 199

  Fly   171 ------DIALIRFNEPVRLGIDMHPVCMPTPSENYA---GQTAVVTGWGALSEGG--PISDTLQE 224
                  ||.|::..:.::....:.|:|:  |..:|.   .....|||||.....|  |...|:||
Human   200 WVGQANDIGLLKLKQELKYSNYVRPICL--PGTDYVLKDHSRCTVTGWGLSKADGMWPQFRTIQE 262

  Fly   225 VEVPILSQEECRNSNYGESK-------ITDNMICAGYVEQGGKDS-CQGDSGGPMHVLGSGDAYQ 281
            .||.||:.:||.|..:..:|       |...|:||   |...::. |...:|.|: |......:.
Human   263 KEVIILNNKECDNFYHNFTKIPTLVQIIKSQMMCA---EDTHREKFCYELTGEPL-VCSMEGTWY 323

  Fly   282 LAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRDACSCAQPEAAGEPASPMET 336
            |.|:||||.||.|..||.:|.:|.|:..||.:       |...:|...|| |..|
Human   324 LVGLVSWGAGCQKSEAPPIYLQVSSYQHWIWD-------CLNGQALALPA-PSRT 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 71/252 (28%)
Tryp_SPc 83..314 CDD:238113 73/254 (29%)
PRSS50NP_037402.1 Tryp_SPc 118..353 CDD:238113 71/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.