DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and F11

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_006253206.1 Gene:F11 / 290757 RGDID:1309364 Length:622 Species:Rattus norvegicus


Alignment Length:257 Identity:91/257 - (35%)
Similarity:139/257 - (54%) Gaps:22/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CSCGNINT---RHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNG------ 127
            |...|:.|   |.|:.||..:...|:||.:.|.......||.|::.:::.||||||.:|      
  Rat   374 CKMDNVCTTKIRPRVFGGAASVHGEWPWQVTLHTTQGHLCGGSIIGNRWILTAAHCFSGTETPKT 438

  Fly   128 --FYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPV 190
              .|..::       |:.:.:......||..::||.:|::.....||||::....:.......|:
  Rat   439 LRVYGGIV-------NQSEINEDTTFFRVQEMIIHDQYTSAESGFDIALLKLEPAMNYTDFQRPI 496

  Fly   191 CMPTPSE-NYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGY 254
            |:|:..: |.......|||||.......:..|||:.:||::|.|||: :.|.:.|||:.:|||||
  Rat   497 CLPSKGDRNVVHTECWVTGWGYTKSRDEVQSTLQKAKVPLVSNEECQ-TRYRKHKITNKVICAGY 560

  Fly   255 VEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR 316
             ::||||:|:||||||:....:| .:.|.||.||||||.:...|||||.|..:.|||.|.|:
  Rat   561 -KEGGKDTCKGDSGGPLSCKHNG-VWHLVGITSWGEGCGQKERPGVYTNVAKYVDWILEKTQ 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 83/237 (35%)
Tryp_SPc 83..314 CDD:238113 84/239 (35%)
F11XP_006253206.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..374 CDD:128519 91/257 (35%)
Tryp_SPc 387..615 CDD:214473 83/237 (35%)
Tryp_SPc 388..615 CDD:238113 82/236 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.