DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tmprss15

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_038944148.1 Gene:Tmprss15 / 288291 RGDID:1311046 Length:1028 Species:Rattus norvegicus


Alignment Length:324 Identity:109/324 - (33%)
Similarity:165/324 - (50%) Gaps:38/324 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 HLLLILATALGDLACATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKREC 69
            |||     .||....:.|.|.:...|...||   :....|.      ||.|.:.....|....:|
  Rat   721 HLL-----GLGSANSSMPILSTGGGPFVRLN---EAPNGSL------ILTPSLQCSQDSLILLQC 771

  Fly    70 AECSCGNINTRH----RIVGGQETEVHEYPWMIMLMW----FGNFYCGASLVNDQYALTAAHCVN 126
            ...|||......    :||||.:|:...:||::.|.:    .....||||||:..:.::||||| 
  Rat   772 NHKSCGEKMVTQKVGPKIVGGSDTQAGAWPWVVALYYRDRSGDRLLCGASLVSSDWLVSAAHCV- 835

  Fly   127 GFYHRLI-----TVRLLEHNRQD-SHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGI 185
              |.|.:     |..|..|.:.: :..::|.|.|.|::|:|.|..|...:|||::.....|....
  Rat   836 --YRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDRIVINPHYDKRRKVNDIAMMHLEFKVNYTD 898

  Fly   186 DMHPVCMPTPSENYA-GQTAVVTGWG--ALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITD 247
            .:.|:|:|..::.:. |:...:.|||  .::.|..: |.|:|.:||::|.|:|: ....|..||:
  Rat   899 YIQPICLPEENQTFTPGRMCSIAGWGYNKINAGSTV-DVLKEADVPLVSNEKCQ-QQLPEYDITE 961

  Fly   248 NMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            :|:|||| |:||.||||||||||: :....:.:.|.|:.|:|..||.||.||||.||..|.:||
  Rat   962 SMLCAGY-EEGGTDSCQGDSGGPL-MCQENNRWFLVGVTSFGVQCALPNHPGVYARVSQFIEWI 1023

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 88/241 (37%)
Tryp_SPc 83..314 CDD:238113 90/242 (37%)
Tmprss15XP_038944148.1 SEA 54..155 CDD:214554
LDLa 188..221 CDD:238060
CUB 229..335 CDD:412131
MAM 351..507 CDD:395504
CUB 528..635 CDD:395345
LDLa 647..681 CDD:238060
Tryp_SPc 789..1025 CDD:238113 90/242 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.