DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss34

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:255 Identity:88/255 - (34%)
Similarity:132/255 - (51%) Gaps:38/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IVGGQETEVHEYPWMIMLMWFG------NFYCGASLVNDQYALTAAHCV-------NGFYHRLIT 134
            ||||.......:||.:.|.::.      ...||.||::.|:.|||||||       :.|..::..
  Rat    33 IVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVELKEMEASCFRVQVGQ 97

  Fly   135 VRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTR---NFDSDIALIRFNEPVRLGIDMHPVCMPTPS 196
            :||.|:::.        .:|::::.|||:|.:   ...:||||::.:..|.|...:|||.:|..|
  Rat    98 LRLYENDQL--------MKVAKIIRHPKFSEKLSAPGGADIALLKLDSTVVLSERVHPVSLPAAS 154

  Fly   197 ENYAG-QTAVVTGWGALSEGGPISDT--LQEVEVPILSQEECRNSNYGESK-------ITDNMIC 251
            :..:. :|..|.|||.:....|:...  |:||.|||:...:|.......|.       |.|:|:|
  Rat   155 QRISSKKTWWVAGWGVIEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLC 219

  Fly   252 AGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            ||   ..|:||||.|||||: |.....::...|:||||.||..|:.|||||||.|:..||
  Rat   220 AG---MEGRDSCQADSGGPL-VCRWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 86/253 (34%)
Tryp_SPc 83..314 CDD:238113 88/255 (35%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 88/255 (35%)
Tryp_SPc 33..275 CDD:214473 86/253 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.