DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss29

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:261 Identity:92/261 - (35%)
Similarity:130/261 - (49%) Gaps:52/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IVGGQETEVHEYPWMIML--------MWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLE 139
            ||||......::||.:.|        .|.  ..||.|:::.|:.||||||::            |
  Rat    31 IVGGNSAPQGKWPWQVSLRVYRYNWASWV--HICGGSIIHPQWVLTAAHCIH------------E 81

  Fly   140 HNRQDSHVKIV---------DR--RVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCM- 192
            .:...|..:|.         ::  :||||:|||.:......||:||::..:.||...::.||.: 
  Rat    82 SDADPSAFRIYLGQVYLYGGEKLLKVSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPNVKPVKLS 146

  Fly   193 PTPSENYAGQTAVVTGWGALS--EGGPISDTLQEVEVPILSQEEC--------RNSNYGESKITD 247
            |...|........|||||::|  |..|....||:|:|.|:....|        |.||:|:..|..
  Rat   147 PASLEVTKKDVCWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTLCEKLYRNATRLSNHGQRLILQ 211

  Fly   248 NMICAGYVEQGGKDSCQGDSGGPM--HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDW 310
            :|:|||   ..|:|||.||||||:  :|.||   :.|.|:||||.|||..:.||||.||..|..|
  Rat   212 DMLCAG---SHGRDSCYGDSGGPLVCNVTGS---WTLVGVVSWGYGCALKDIPGVYARVQFFLPW 270

  Fly   311 I 311
            |
  Rat   271 I 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 90/259 (35%)
Tryp_SPc 83..314 CDD:238113 92/261 (35%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346500
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.