DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss27

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:262 Identity:98/262 - (37%)
Similarity:140/262 - (53%) Gaps:25/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ECAEC--SCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVN---- 126
            |.||.  :||:....:|:|||::....|:||.:.:...|..:||.||:...:.||||||.:    
  Rat    21 EGAEAMRACGHPRMFNRMVGGEDALEGEWPWQVSIQRNGAHFCGGSLIAPTWVLTAAHCFSNTSD 85

  Fly   127 -GFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPV 190
             ..|..|:..  |:..:...|...|.  |.||..||:|......:|:||:....||.....:.||
  Rat    86 ISIYQVLLGA--LKLQQPGPHALYVP--VKRVKSHPEYQGMASSADVALVELQVPVTFTKYILPV 146

  Fly   191 CMPTPSENY-AGQTAVVTGWGALSEGG--PISDTLQEVEVPILSQEECRNSNYGE--------SK 244
            |:|.||..: :|....|||||:.||..  |....||::.||::...:| |..|.:        ..
  Rat   147 CLPDPSVVFKSGMNCWVTGWGSPSEQDRLPNPRILQKLAVPLIDTPKC-NLLYSKDAEADIQLKT 210

  Fly   245 ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFND 309
            |.|:|:|||:.| |.||:|:||||||:..| ...::..||::|||||||:.|.||||.||.|...
  Rat   211 IKDDMLCAGFAE-GKKDACKGDSGGPLVCL-VDQSWVQAGVISWGEGCARRNRPGVYIRVASHYQ 273

  Fly   310 WI 311
            ||
  Rat   274 WI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 91/244 (37%)
Tryp_SPc 83..314 CDD:238113 92/245 (38%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 91/244 (37%)
Tryp_SPc 39..278 CDD:238113 92/244 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.