DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss30

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:274 Identity:108/274 - (39%)
Similarity:147/274 - (53%) Gaps:37/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFY-CGASLVNDQYALTAAHCV-----NGFYHRLITVRLLEH 140
            :|||||:.....:||.:.|......: ||.||:::.:.||||||.     :.|||  :.|..|..
  Rat    30 KIVGGQDAPEGRWPWQVSLRTEKEGHICGGSLIHEVWVLTAAHCFCRPLNSSFYH--VKVGGLTL 92

  Fly   141 NRQDSHVKIVDRRVSRVLIHPKYSTRNFDS-DIALIRFNEPVRLGIDMHPVCMP------TPSEN 198
            :..:.|..:|  .|..:.::|.|...:..| ||||:|.:.|::.. ...|||:|      ||   
  Rat    93 SLTEPHSTLV--AVRNIFVYPTYLWEDASSGDIALLRLDTPLQPS-QFSPVCLPQAQAPLTP--- 151

  Fly   199 YAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEEC-RNSNYGESK------ITDNMICAGYVE 256
              |....||||||..| ..::..|||:.||:|..|:| |..:.||:.      |..:|:|||:||
  Rat   152 --GTVCWVTGWGATHE-RELASVLQELAVPLLDSEDCERMYHIGETSLSGKRVIQSDMLCAGFVE 213

  Fly   257 QGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI----AENTRD 317
             |.|||||||||||: |.....::...||.|||.|||:||.|||||||..:.|||    |||..|
  Rat   214 -GQKDSCQGDSGGPL-VCAINSSWIQVGITSWGIGCARPNKPGVYTRVPDYVDWIQRTLAENHSD 276

  Fly   318 ACSCAQPEAAGEPA 331
            |..|....:...||
  Rat   277 AYGCRSRASGAYPA 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 98/248 (40%)
Tryp_SPc 83..314 CDD:238113 101/254 (40%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.