DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and LOC286960

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:243 Identity:96/243 - (39%)
Similarity:133/243 - (54%) Gaps:24/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 INTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHN 141
            :|...:||||.....|..|:.:.|....:..||.||::||:.|:||||    |.|.:.|||.|||
  Rat    18 VNDDDKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHC----YKRKLQVRLGEHN 78

  Fly   142 RQDSHV-----KIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAG 201
               .||     :.:|  ..:::.||:|:....|:||.||:...|..|...:..|.:|....:...
  Rat    79 ---IHVLEGGEQFID--AEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDA 138

  Fly   202 QTAVVTGWG-ALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQG 265
            | .:|:||| .:|.||.....||.:|.|:||...|:.|..|:  ||.||.|.|::| ||||||.|
  Rat   139 Q-CLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQ--ITSNMFCLGFLE-GGKDSCDG 199

  Fly   266 DSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAE 313
            |||||:...|     ::.||||||..||....|||||:|.::..||.|
  Rat   200 DSGGPVVCNG-----EIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 92/234 (39%)
Tryp_SPc 83..314 CDD:238113 95/237 (40%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 92/234 (39%)
Tryp_SPc 24..243 CDD:238113 95/237 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.