DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG33225

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:263 Identity:76/263 - (28%)
Similarity:124/263 - (47%) Gaps:43/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRH-----RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLI 133
            ||  .|||     |:|||.:.:....|||:|::...|.:|..||:...:.||:|.|:.....::|
  Fly    45 CG--TTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSGSLITRLFVLTSASCLLSLPKQVI 107

  Fly   134 TVRLLEHNRQ------DSHVKIVDRRVSRVLIHPKYSTRNFDS-DIALIRFNEPVRLGIDMHPVC 191
               |.|::|.      .|..:::|  :.:.:||.::....... ||||:|..:.|.:...:.|:|
  Fly   108 ---LGEYDRNCTSADCTSIRQVID--IDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRPIC 167

  Fly   192 MPTPSENYAGQTA---VVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAG 253
            :..  :...|::.   ..||||......| |..||.|.:..::::.|:...  ...|..:.:|.|
  Fly   168 LSV--DRQVGRSVQHFTATGWGTTEWNEP-STILQTVTLSKINRKYCKGRL--RQNIDASQLCVG 227

  Fly   254 YVEQGGKDSCQGDSGGPMHVL----GSGD------AYQLAGIVSWGEGCAKPNAPGVYTRVGSFN 308
            ...   ||:|.||:|||:.:.    |.|.      |: |.||||:|....  :..||||.|..:.
  Fly   228 GPR---KDTCSGDAGGPLSLTLKIDGDGKWNNKSRAF-LIGIVSYGSSSC--SGIGVYTNVEHYM 286

  Fly   309 DWI 311
            |||
  Fly   287 DWI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 69/248 (28%)
Tryp_SPc 83..314 CDD:238113 70/249 (28%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 69/248 (28%)
Tryp_SPc 57..292 CDD:238113 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.