DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG33459

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:265 Identity:90/265 - (33%)
Similarity:127/265 - (47%) Gaps:34/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITV 135
            |.:||.|..|.||.||.:..:...|||..|.....|.||.||:..::.|||||||......| ||
  Fly    26 EPNCGQIPFRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCVMPTPKNL-TV 89

  Fly   136 RLLEHN--RQDSHVKIVDRR----VSRVLIHPKYSTRNFDS-DIALIRFNEPVRLGIDMHPVCMP 193
            ||.|::  ||...:....|.    |:|:..||.|  |:..: ||||::.|:.|...:.:.|:|:.
  Fly    90 RLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSY--RSIAAYDIALLKLNQTVEYTVAIRPICLV 152

  Fly   194 TPSENY--------AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMI 250
            .| ||:        :.:...:||||| ::..|:|..||...:..:.:..| :..||.| :....|
  Fly   153 LP-ENFHEWYWLVDSVEDFTLTGWGA-TKTEPVSQVLQSANLTQIDRGTC-HDRYGHS-VDHTHI 213

  Fly   251 CAGYVEQGGKDSCQGDSGGPMH---VLGSGDAYQLAGIVSWGEGCAKPNAPG--VYTRVGSFNDW 310
            |||   .....:|.||||.|:.   |......:...||||.|    ..|..|  |:|.|.||.:|
  Fly   214 CAG---SSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRG----PKNCDGVTVFTNVVSFTEW 271

  Fly   311 IAENT 315
            |...|
  Fly   272 IFRTT 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 82/248 (33%)
Tryp_SPc 83..314 CDD:238113 83/250 (33%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 82/248 (33%)
Tryp_SPc 38..272 CDD:238113 81/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.