DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG33461

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:265 Identity:73/265 - (27%)
Similarity:115/265 - (43%) Gaps:39/265 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ECSCGNI-NTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLIT 134
            |.:||.: ...::|:.|....:..||||..|.....|.|..||:|..:.||:|||:.....  :.
  Fly    29 EENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLCAGSLINQWFVLTSAHCIEDDVE--LI 91

  Fly   135 VRLLEHNRQDSHVKIVDRR---------VSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPV 190
            .||.|:|| |:.:...:.|         |..:..|..|..::|.:||.::|....|.....:.|:
  Fly    92 ARLGENNR-DNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPI 155

  Fly   191 CMPTPSENYAGQTAVV--------TGWGALSE--GGPISDTLQEVEVPILSQEECRNSNYGESKI 245
            |:    .::.....||        ||||..|.  ....|..|.|:.:....:.:|  :...:...
  Fly   156 CI----FHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDC--ARIFKQNF 214

  Fly   246 TDNMICAGYVEQGGKDSCQGDSGGPM--HVLGSG-DAYQLAGIVSWG-EGCAKPNAPGVYTRVGS 306
            ....||||. :.|  :.|:||||||.  :||..| ..:...||.|:. |.|:|.:   :.|.|..
  Fly   215 LSGQICAGN-DDG--NLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSKVS---ILTDVVR 273

  Fly   307 FNDWI 311
            :..||
  Fly   274 YGRWI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 68/251 (27%)
Tryp_SPc 83..314 CDD:238113 70/252 (28%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 68/251 (27%)
Tryp_SPc 42..281 CDD:238113 70/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.