DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and GAS6

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_000811.1 Gene:GAS6 / 2621 HGNCID:4168 Length:678 Species:Homo sapiens


Alignment Length:312 Identity:63/312 - (20%)
Similarity:86/312 - (27%) Gaps:125/312 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLILATALGDLACATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECA 70
            |||:||.     .||..:|..|.:..:.|....:.....|.:..|..|            :|||.
Human    19 LLLLLAA-----ECALAALLPAREATQFLRPRQRRAFQVFEEAKQGHL------------ERECV 66

  Fly    71 ECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITV 135
            |..|.....|.......||: :.||..:                        .|:|         
Human    67 EELCSREEAREVFENDPETD-YFYPRYL------------------------DCIN--------- 97

  Fly   136 RLLEHNRQDSHVKIVDRRVSRVLIHPKYS---TRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSE 197
                                      ||.   |:|  |..|....|.|.:        |.|.|.:
Human    98 --------------------------KYGSPYTKN--SGFATCVQNLPDQ--------CTPNPCD 126

  Fly   198 NYAGQTA----------VVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICA 252
            ....|..          ...||     ||.:.|  ::|       .||...|.|..:|..|    
Human   127 RKGTQACQDLMGNFFCLCKAGW-----GGRLCD--KDV-------NECSQENGGCLQICHN---- 173

  Fly   253 GYVEQGGKDSCQGDSGGPMHVLG--SGDAYQLAGIVSWGEGCAKPNAPGVYT 302
                :.|...|...||..:...|  ..|..:.|...:.||...| |.||.|:
Human   174 ----KPGSFHCSCHSGFELSSDGRTCQDIDECADSEACGEARCK-NLPGSYS 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 44/236 (19%)
Tryp_SPc 83..314 CDD:238113 44/235 (19%)
GAS6NP_000811.1 Gla 53..92 CDD:306960 13/51 (25%)
EGF_CA 118..153 CDD:238011 8/47 (17%)
FXa_inhibition 160..195 CDD:317114 10/42 (24%)
EGF_CA 197..>227 CDD:214542 9/25 (36%)
vWFA <232..273 CDD:320736
LamG 298..450 CDD:238058
Laminin_G_2 513..651 CDD:308045
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.