DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and PRSS33

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:253 Identity:100/253 - (39%)
Similarity:134/253 - (52%) Gaps:19/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLI---- 133
            :||......|||||::....|:||...:...|...||.||:..|:.||||||   |..|.:    
Human    27 ACGQPRMSSRIVGGRDGRDGEWPWQASIQHRGAHVCGGSLIAPQWVLTAAHC---FPRRALPAEY 88

  Fly   134 TVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTP-SE 197
            .|||.......:..:.:...|.|||:.|.||......|:||::...||.|...:.|||:|.| :.
Human    89 RVRLGALRLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALLQLRRPVPLSARVQPVCLPVPGAR 153

  Fly   198 NYAGQTAVVTGWGALSEGGPISD--TLQEVEVPILSQEECRNSNY-------GESKITDNMICAG 253
            ...|....|||||:|..|.|:.:  .||.|.||:|....|....:       .|..:....:|||
Human   154 PPPGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTCDGLYHVGADVPQAERIVLPGSLCAG 218

  Fly   254 YVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            | .||.||:||||||||:..|.|| ::.|.|:||||:|||.||.|||||.|.:::.||
Human   219 Y-PQGHKDACQGDSGGPLTCLQSG-SWVLVGVVSWGKGCALPNRPGVYTSVATYSPWI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 96/242 (40%)
Tryp_SPc 83..314 CDD:238113 97/243 (40%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 97/243 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4746
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3952
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.