DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Cma1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_037224.1 Gene:Cma1 / 25627 RGDID:2365 Length:247 Species:Rattus norvegicus


Alignment Length:256 Identity:77/256 - (30%)
Similarity:120/256 - (46%) Gaps:36/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GNINTRHRIVGGQETEVHEYPWM--IMLMWFGNFY--CGASLVNDQYALTAAHCVNGFYHRLITV 135
            |:......|:||.|...|..|:|  :.::...|:.  |...|:...:.||||||..    |.|||
  Rat    14 GSSTKAGEIIGGTECIPHSRPYMAYLEIVTSDNYLSACSGFLIRRNFVLTAAHCAG----RSITV 74

  Fly   136 RLLEHN---RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVR--LGIDMHPVCMPTP 195
            .|..||   ::|:..|:   .|.:..|||.|..|....||.|::..|..:  ||:...|:     
  Rat    75 LLGAHNKTYKEDTWQKL---EVEKQFIHPNYDKRLVLHDIMLLKLKEKAKLTLGVGTLPL----- 131

  Fly   196 SENY----AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVE 256
            |.|:    .|:.....|||..:...|.|||||||::.:...:.|::....:.|   :.:|.|..:
  Rat   132 SANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQSCKHFTSFQHK---SQLCVGNPK 193

  Fly   257 QGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRD 317
            : .::..:||||||:...|...     ||.|:....|||  |.|:||:..:..||.:..|:
  Rat   194 K-MQNVYKGDSGGPLLCAGIAQ-----GIASYVHPNAKP--PAVFTRISHYRPWINKILRE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 73/241 (30%)
Tryp_SPc 83..314 CDD:238113 75/243 (31%)
Cma1NP_037224.1 Tryp_SPc 21..240 CDD:214473 73/241 (30%)
Tryp_SPc 22..243 CDD:238113 75/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.