DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Proc

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_008770240.3 Gene:Proc / 25268 RGDID:3411 Length:500 Species:Rattus norvegicus


Alignment Length:242 Identity:90/242 - (37%)
Similarity:134/242 - (55%) Gaps:20/242 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWM-IMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDS 145
            |||.|..|:..:.||. |:|.......||..|::..:.||||||:..  .:.:||||.|::.:..
  Rat   251 RIVNGTLTKQGDSPWQAILLDSKKKLACGGVLIHTSWVLTAAHCLES--SKKLTVRLGEYDLRRR 313

  Fly   146 HVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMP----TPSENYAGQTAVV 206
            ....:|..:..||:||.|:..|.|:||||:|.::|..|...:.|:|:|    ....:.|||..||
  Rat   314 DPWELDLDIKEVLVHPNYTRSNSDNDIALLRLSQPATLSKTIVPICLPNSGLAQELSQAGQETVV 378

  Fly   207 TGWGALSEGGPISD-------TLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQ 264
            ||||..|:  .:.|       .|..:.:|:.::.:|  .....:.:::||:|||.:.. .:|:|.
  Rat   379 TGWGYQSD--KVKDGRRNRTFILTFIRIPLAARNDC--MQVMNNVVSENMLCAGIIGD-TRDACD 438

  Fly   265 GDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            |||||||.|...| .:.|.|:|||||||...|..||||:|||:..||
  Rat   439 GDSGGPMVVFFRG-TWFLVGLVSWGEGCGHLNNYGVYTKVGSYLKWI 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 88/240 (37%)
Tryp_SPc 83..314 CDD:238113 89/241 (37%)
ProcXP_008770240.3 GLA 65..125 CDD:214503
EGF_CA 126..170 CDD:238011
FXa_inhibition 178..213 CDD:405372
Tryp_SPc 252..486 CDD:238113 89/241 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12321
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.