DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Klkb1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:263 Identity:97/263 - (36%)
Similarity:142/263 - (53%) Gaps:25/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ECAECSCGNINTRHRIVGGQETEVHEYPWMIML---MWFGNFYCGASLVNDQYALTAAHCVNG-- 127
            |.::|:. .||.  |||||..:.:.|:||.:.|   :...|..||.|::..|:.||||||.:|  
  Rat   379 ESSDCTT-KINA--RIVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIP 440

  Fly   128 ------FYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGID 186
                  .|..::.:..:.:....|.:|       .::||.||.......|||||:...|:.....
  Rat   441 YPDVWRIYGGILNLSEITNKTPFSSIK-------ELIIHQKYKMSEGSYDIALIKLQTPLNYTEF 498

  Fly   187 MHPVCMPTPSE-NYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMI 250
            ..|:|:|:.:: |.......|||||...|.|...:.||:..:|::..|||: ..|.:..||..||
  Rat   499 QKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATIPLVPNEECQ-KKYRDYVITKQMI 562

  Fly   251 CAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
            |||| ::||.|:|:||||||:....|| .:||.||.|||||||:...|||||:|..:.|||.|..
  Rat   563 CAGY-KEGGIDACKGDSGGPLVCKHSG-RWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKI 625

  Fly   316 RDA 318
            :.:
  Rat   626 QSS 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 90/240 (38%)
Tryp_SPc 83..314 CDD:238113 91/242 (38%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 90/240 (38%)
Tryp_SPc 391..621 CDD:238113 89/239 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45531
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.