DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and F9

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_113728.1 Gene:F9 / 24946 RGDID:2589 Length:462 Species:Rattus norvegicus


Alignment Length:250 Identity:86/250 - (34%)
Similarity:136/250 - (54%) Gaps:21/250 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 INTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHN 141
            ||...|:|||:..:..:.||.::|......:||.:::|:::.:|||||:..  ...|.|...|||
  Rat   222 INDFTRVVGGENAKPGQIPWQVILNGEIEAFCGGAIINEKWIVTAAHCLKP--GDKIEVVAGEHN 284

  Fly   142 ---RQDSHVKIVDRRVSRVLIHPKYST--RNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAG 201
               ::|:..:   |.|.|.:.|.:|:.  ..:..||||:..::|:.|...:.|:|:  .::.|..
  Rat   285 IDEKEDTEQR---RNVIRTIPHHQYNATINKYSHDIALLELDKPLILNSYVTPICV--ANKEYTN 344

  Fly   202 -----QTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKD 261
                 .:..|:|||.:...|..:..||.:.||::.:..|..|.  :..|.:||.|||| .:||||
  Rat   345 IFLKFGSGYVSGWGKVFNKGRQASILQYLRVPLVDRATCLRST--KFSIYNNMFCAGY-REGGKD 406

  Fly   262 SCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR 316
            ||:|||||| ||........|.||:||||.||.....|:||:|..:.:||.|.|:
  Rat   407 SCEGDSGGP-HVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTK 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 80/238 (34%)
Tryp_SPc 83..314 CDD:238113 81/240 (34%)
F9NP_113728.1 GLA 21..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 127..163 CDD:291342
Tryp_SPc 227..455 CDD:214473 80/238 (34%)
Tryp_SPc 228..458 CDD:238113 81/240 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12321
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.