DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG30288

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:267 Identity:82/267 - (30%)
Similarity:122/267 - (45%) Gaps:46/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ECSCGNINT---RHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRL 132
            |..||..::   |.||.||::..:...|||:.:|..|...||.||:..::.|||.||::..|   
  Fly    28 ENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAVCGGSLITARFVLTAEHCISPMY--- 89

  Fly   133 ITVRLLEHNRQ------DSHV---KIVDRRVSRVLIH--PKYSTRNFDSDIALIRFNEPVRLGID 186
            :.|||.|::.:      |..|   :..:..|.|.::|  |.|       ||.|:|....|.....
  Fly    90 MNVRLGEYDTRHPIFDCDDFVCTPRAYNVDVDRKIVHSNPGY-------DIGLLRMQRSVIFSNY 147

  Fly   187 MHPVCMPTPSENYAGQTAVV-----TGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKIT 246
            :.|:|: ...:...|....:     ||||..|:|.. .|.||...:..|.|..|....   ..:.
  Fly   148 VRPICL-ILGKTLGGNPLSILRFNFTGWGTNSDGEE-QDRLQTATLQQLPQWSCERPG---RPLD 207

  Fly   247 DNMICAG-YVEQGGKDSCQGDSGGPMHVL----GSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGS 306
            .:.|||| |:    .|||:||||||:..:    |.|..:|. |:.|  :|....:..|:||.|..
  Fly   208 ISYICAGSYI----SDSCKGDSGGPLSAIRTFEGQGRVFQF-GVAS--QGLRLCSGLGIYTNVTH 265

  Fly   307 FNDWIAE 313
            |.|||.:
  Fly   266 FTDWILD 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 76/249 (31%)
Tryp_SPc 83..314 CDD:238113 77/252 (31%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 76/249 (31%)
Tryp_SPc 45..270 CDD:238113 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.