DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG30287

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:261 Identity:76/261 - (29%)
Similarity:121/261 - (46%) Gaps:43/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 HRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQD- 144
            :|::.|:..::...|||::::..|...||.||:..:|.||||||.:....:| ||||.:::... 
  Fly    40 YRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQL-TVRLGDYDVNQA 103

  Fly   145 ---SHVKIVDR----RVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCM----PTPSEN 198
               |....:.|    .|:|..: |.:.|....:||||:|....|:.|.::..:|:    .|.|.|
  Fly   104 VDCSSYGCIPRPREINVTRTYV-PSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSN 167

  Fly   199 YAGQTAV--VTGWGALSEGGPISDTLQEVEVPILSQEECRNSN-------YGESKITDNMICAGY 254
            .......  .||||.         |...:..|:|.|....:.:       :|: ::..:.||   
  Fly   168 ILKNLVKFNTTGWGR---------TESRINSPVLQQASLTHHHLSYCAQVFGK-QLDKSHIC--- 219

  Fly   255 VEQGGKDSCQGDSGGPMHV---LGSGDAYQLAGIVSWGE-GCAKPNAPGVYTRVGSFNDWIAENT 315
            |......:||||||||:..   :||.....|.|:||:|. .|.   .|.|||.|..|.:||..:|
  Fly   220 VASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCF---GPTVYTNVIHFANWIELHT 281

  Fly   316 R 316
            :
  Fly   282 K 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 73/253 (29%)
Tryp_SPc 83..314 CDD:238113 74/255 (29%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 73/253 (29%)
Tryp_SPc 42..280 CDD:238113 74/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.