DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG30098

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:245 Identity:71/245 - (28%)
Similarity:108/245 - (44%) Gaps:36/245 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQ- 143
            |.|::|||  .....|||..|:....|.||.||:..::.||||||..  .:..:.|||.|::.. 
  Fly    34 RIRVIGGQ--NARRTPWMAYLIRDNRFACGGSLIAYRFVLTAAHCTK--INDNLFVRLGEYDSSR 94

  Fly   144 --DSHVKIVDRRVSRVLIHPKY-STRNFDSDIALIRFNEPVRLGIDMHPVCMPTPS--ENYAG-- 201
              |...:  ..||..:..|..| ..||  .|||:::.:..|.....:.|:|:...|  ::.|.  
  Fly    95 TTDGQTR--SYRVVSIYRHKNYIDFRN--HDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSI 155

  Fly   202 QTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGD 266
            |...:||||.::....:..||||     :|....||...|...:  ::.|...|:.    :|.||
  Fly   156 QNFTLTGWGQMAHYYKMPTTLQE-----MSLRRVRNEYCGVPSL--SICCWNPVQY----ACFGD 209

  Fly   267 SGGPMHVL---GSGDAYQLAGIVSWGEGCAKPNAPGV--YTRVGSFNDWI 311
            ||||:..|   |....|...|:.:...|    |..|.  |..:.|:..|:
  Fly   210 SGGPLGSLVKYGHKTIYVQFGVTNSVTG----NCDGYSSYLDLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 69/241 (29%)
Tryp_SPc 83..314 CDD:238113 69/242 (29%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 69/240 (29%)
Tryp_SPc 37..258 CDD:238113 69/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.