DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG30091

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:293 Identity:89/293 - (30%)
Similarity:134/293 - (45%) Gaps:58/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 WSSPAKRECAEC---SCG-NINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTA 121
            |...|.|..|..   .|| .:....:||||.:....:.|||.::.....|.||.|::.:::.|||
  Fly    11 WMLTAGRGSARLLDEDCGVPMQLIPKIVGGVDAGELKNPWMALIKTNDEFICGGSVITNKFVLTA 75

  Fly   122 AHCV----------------NGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDS 170
            |||:                .|.||.|.|.   |||......     .|.||.||..::.:|:.:
  Fly    76 AHCMCTDEECIVKYTQLTVTLGVYHLLATG---EHNHPHEIY-----NVERVYIHDSFAIQNYRN 132

  Fly   171 DIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVV-----TGWGALSEGGPISDTLQEVEVPIL 230
            ||||:|..:.:.....:.|:|: ..::....||.::     .||| ::..|.:|:.||.|::..:
  Fly   133 DIALLRLQKSIVYKPQIKPLCI-LLNDQLKPQTDLIQEFTAIGWG-VTGNGKMSNNLQMVKIYRI 195

  Fly   231 SQEECRNS-----NYGESKITDNMICAGYVEQGGKDSCQGDSGGPM--HVLGSG--DAYQLAGIV 286
            .::.|..:     :|       .|.|||...  |:|:|:.|||||:  |:|..|  .|.|| |||
  Fly   196 DRKMCEAAFWYTFDY-------PMFCAGTAV--GRDTCKRDSGGPLYIHMLFDGIKRATQL-GIV 250

  Fly   287 SWG-EGCAKPNAPGVYTRVGSFNDWIAENTRDA 318
            |.| |.|   ...|:||.|....|:|.....||
  Fly   251 STGTEDC---RGFGMYTDVMGHIDFIERIVLDA 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 80/259 (31%)
Tryp_SPc 83..314 CDD:238113 81/261 (31%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 80/259 (31%)
Tryp_SPc 37..276 CDD:238113 81/261 (31%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.