DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG30090

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:287 Identity:84/287 - (29%)
Similarity:126/287 - (43%) Gaps:65/287 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CSCGN-----------INT-RHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHC 124
            ||.||           .|| ..:|:||::..::..|||..:.......||.:|:..::.||||||
  Fly    17 CSLGNGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICGGTLITQRFVLTAAHC 81

  Fly   125 VNGFYHRLITVRLLEHN---RQDSHVKIV-----DRRVSRVLIHPKYSTRNFDSDIALIRFNEPV 181
            ||  ....:.|||.|::   .:|.:.||.     :..|.....|.|:|.....:||||:|..:.|
  Fly    82 VN--EGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFV 144

  Fly   182 RLGIDMHPVC--MPTPSENYAG--QTAVVTGWGAL----SEGGPISDTLQEVEVPILSQEECRNS 238
            .....:.|:|  :.|.......  :..|.||||..    :.|     .||..::...:..:|..:
  Fly   145 TFKAHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRG-----VLQITQLQRYNSSQCMQA 204

  Fly   239 NYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLA-----------GIVSWGEGC 292
             .|. .:..|.||||.:   |.|:|.||||||:        :|..           |:||:|.  
  Fly   205 -LGR-LVQQNQICAGRL---GSDTCNGDSGGPL--------FQTVRHMDKMRPVQFGVVSYGS-- 254

  Fly   293 AKPNAPGVYTRVGSFNDWIA----ENT 315
            .:.:..||||.|.|:.||||    :||
  Fly   255 RECSGIGVYTDVYSYADWIATVVQQNT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 73/255 (29%)
Tryp_SPc 83..314 CDD:238113 76/261 (29%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 73/255 (29%)
Tryp_SPc 40..276 CDD:238113 76/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.