DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG30087

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:274 Identity:85/274 - (31%)
Similarity:130/274 - (47%) Gaps:43/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VPAEWSSPAKRECAECSCG---NINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYA 118
            |.|::.:|.        ||   ...|..|:|.|:|..:...|:|:.:......:||.|::|.:|.
  Fly    21 VDAQFLNPL--------CGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGSILNSRYI 77

  Fly   119 LTAAHCVNGFYHRLITVRLLEHN-RQDSHV-------KIVDRRVSRVLIHPKYSTRNFDSDIALI 175
            |||||||  |.:  :.:||.||| |.|...       :..:..:.:.:.|..|:..|..:||||:
  Fly    78 LTAAHCV--FPN--LRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALL 138

  Fly   176 RFNEPVRLGIDMHPVCMPTPSENYAGQTAVVT----GWGALSEGGPISDTLQEVEVPILSQEECR 236
            :.|..:...:.:.|:|:..   |.|...:|.|    |||...:.| ....||..|:.......|.
  Fly   139 KLNRSINFNVHIQPICILL---NPASAPSVATYQTFGWGETKKNG-FPHLLQTAELRAYDAAYCS 199

  Fly   237 NSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDA---YQLAGIVSWG-EGCAKPNA 297
            .|.:  :.:..|.||||:.|   :|:|.||||||:......|.   |...||||:| ..|   .:
  Fly   200 RSFH--AYMNGNQICAGHEE---RDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDC---QS 256

  Fly   298 PGVYTRVGSFNDWI 311
            |||||.|.::.:||
  Fly   257 PGVYTYVPNYINWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 77/244 (32%)
Tryp_SPc 83..314 CDD:238113 78/245 (32%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 77/244 (32%)
Tryp_SPc 42..272 CDD:238113 78/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.