DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG30082

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:303 Identity:95/303 - (31%)
Similarity:141/303 - (46%) Gaps:65/303 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 WIQSI-----LGPEVPAEWSSPAKRECAECSCG---NINTRHRIVGGQETEVHEYPWMIMLMWFG 104
            ||.|.     |.|::.|::..|        :||   |:...:|||||:..::...||:..|....
  Fly     5 WIASFAFLVCLTPKLRAQFIDP--------NCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNS 61

  Fly   105 NFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKI-----------VDRRVSRVL 158
            :..|..:|:..::.||||||::.|:  |:||||.|:   |:..:|           .:..|....
  Fly    62 SLVCTGTLITKRFVLTAAHCLHSFH--LLTVRLGEY---DTSTRIDCTSEFCIPTYEEYSVENAY 121

  Fly   159 IHPKYSTRNFDS--DIALIRFNEPVRLGIDMHPVCM-PTPSENYAGQTAVVTGWGALSEGGPISD 220
            ||..:..|. ||  ||.|::.|..|...:.:.|:|: ..|.:.....|....|||.:.    :.:
  Fly   122 IHTFFGGRQ-DSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSSTYEAAGWGKID----LIN 181

  Fly   221 T---LQEVEVPILSQEECRNS-----NYGESKITDNMICAGYVEQGGKDSCQGDSGGPM-HVLGS 276
            |   ||.|.:..|.|.:|..|     :||:       .|||   |...|:|.||||||: ..:.:
  Fly   182 TATVLQTVNLIRLDQSDCERSLRTSLSYGQ-------FCAG---QWRADTCSGDSGGPLSRKMSN 236

  Fly   277 G---DAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR 316
            |   ...|| ||||:|....:  .|||||.|.||.:||...||
  Fly   237 GRITRTVQL-GIVSYGHYLCR--GPGVYTYVPSFTNWILSITR 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 81/254 (32%)
Tryp_SPc 83..314 CDD:238113 82/256 (32%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 81/254 (32%)
Tryp_SPc 40..274 CDD:238113 82/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.